Lineage for d2fxma1 (2fxm A:838-963)
- Root: SCOPe 2.08
Class h: Coiled coil proteins [57942] (7 folds) Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
this is not a true fold; includes oligomers of shorter identical helices
Superfamily h.1.26: Myosin rod fragments [90257] (2 families) 
Family h.1.26.1: Myosin rod fragments [90258] (2 proteins) 
Protein Myosin heavy chain, cardiac muscle beta isoform [144264] (1 species) Species Human (Homo sapiens) [TaxId:9606] [144265] (2 PDB entries)
Uniprot P12883 838-963
Domain d2fxma1: 2fxm A:838-963 [134327]
complexed with hg
Details for d2fxma1
PDB Entry: 2fxm (more details), 2.7 Å
PDB Description: structure of the human beta-myosin s2 fragment
PDB Compounds: (A:) Myosin heavy chain, cardiac muscle beta isoformSCOPe Domain Sequences for d2fxma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fxma1 h.1.26.1 (A:838-963) Myosin heavy chain, cardiac muscle beta isoform {Human (Homo sapiens) [TaxId: 9606]}
pllksaerekemasmkeeftrlkealeksearrkeleekmvsllqekndlqlqvqaeqdn
ladaeercdqliknkiqleakvkemnerledeeemnaeltakkrkledecselkrdiddl
eltlak
SCOPe Domain Coordinates for d2fxma1:
Click to download the PDB-style file with coordinates for d2fxma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fxma1:
- d2fxma1 first appeared in SCOP 1.73
- d2fxma1 appears in SCOPe 2.07
View in 3D
