Lineage for d2fxea_ (2fxe A:)
- Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds) 
Fold b.50: Acid proteases [50629] (1 superfamily)
barrel, closed; n=6, S=10, complex topologySuperfamily b.50.1: Acid proteases [50630] (4 families) 
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
dimer of identical mono-domain chains, each containing (6,10) barrelProtein Human immunodeficiency virus type 1 protease [50632] (8 species) Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (421 PDB entries)
Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
Domain d2fxea_: 2fxe A: [164507]
automated match to d1fgcc_
complexed with act, dr7, gol, so4; mutant
Details for d2fxea_
PDB Entry: 2fxe (more details), 1.8 Å
PDB Description: x-ray crystal structure of hiv-1 protease crm mutant complexed with atazanavir (bms-232632)
PDB Compounds: (A:) pol proteinSCOPe Domain Sequences for d2fxea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fxea_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrpivtvkiggqlkealldtgaddtvieemnlpgkwkpkmiggiggfikvrqyd
qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
SCOPe Domain Coordinates for d2fxea_:
Click to download the PDB-style file with coordinates for d2fxea_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fxea_:
- d2fxea_ first appeared in SCOPe 2.01
- d2fxea_ appears in SCOPe 2.02
- d2fxea_ appears in SCOPe 2.04
- d2fxea_ appears in the current release, SCOPe 2.08
View in 3D
