Lineage for d2fwoa1 (2fwo A:182-275)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746844Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2747150Species Mouse (Mus musculus) [TaxId:10090] [88606] (111 PDB entries)
    Uniprot P01901 22-299
  8. 2747293Domain d2fwoa1: 2fwo A:182-275 [145177]
    Other proteins in same PDB: d2fwoa2, d2fwob_

Details for d2fwoa1

PDB Entry: 2fwo (more details), 2.6 Å

PDB Description: mhc class i h-2kd heavy chain in complex with beta-2microglobulin and peptide derived from influenza nucleoprotein
PDB Compounds: (A:) H-2 class I histocompatibility antigen, K-D alpha chain

SCOPe Domain Sequences for d2fwoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fwoa1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvtyhprsqvdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf
qkwaavvvplgkeqnytchvhhkglpepltlrwk

SCOPe Domain Coordinates for d2fwoa1:

Click to download the PDB-style file with coordinates for d2fwoa1.
(The format of our PDB-style files is described here.)

Timeline for d2fwoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fwoa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2fwob_