Lineage for d2fvva1 (2fvv A:8-142)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971309Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2971538Protein Diphosphoinositol polyphosphate phosphohydrolase [143766] (1 species)
  7. 2971539Species Human (Homo sapiens) [TaxId:9606] [143767] (16 PDB entries)
    Uniprot O95989 8-142
  8. 2971540Domain d2fvva1: 2fvv A:8-142 [134226]
    complexed with cl, ihp, so4

Details for d2fvva1

PDB Entry: 2fvv (more details), 1.25 Å

PDB Description: human diphosphoinositol polyphosphate phosphohydrolase 1
PDB Compounds: (A:) Diphosphoinositol polyphosphate phosphohydrolase 1

SCOPe Domain Sequences for d2fvva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]}
qtrtydgdgykkraaclcfrseseeevllvsssrhpdrwivpgggmepeeepsvaavrev
ceeagvkgtlgrlvgifenqerkhrtyvyvlivtevledwedsvnigrkrewfkiedaik
vlqyhkpvqasyfet

SCOPe Domain Coordinates for d2fvva1:

Click to download the PDB-style file with coordinates for d2fvva1.
(The format of our PDB-style files is described here.)

Timeline for d2fvva1: