Lineage for d2fura1 (2fur A:16-208)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.45: Split barrel-like [50474] (3 superfamilies)
barrel; n=6, S=10; greek-keySuperfamily b.45.1: FMN-binding split barrel [50475] (5 families) 
related to the ferredoxin reductase-like FAD-binding domainFamily b.45.1.1: PNP-oxidase like [50476] (17 proteins) 
Protein Hypothetical protein Ta1372 [141366] (1 species) Species Thermoplasma acidophilum [TaxId:2303] [141367] (1 PDB entry)
Uniprot Q9HIG7 16-208
Domain d2fura1: 2fur A:16-208 [134185]
complexed with edo
Details for d2fura1
PDB Entry: 2fur (more details), 1.8 Å
PDB Description: crystal structure of a putative fmn-binding protein (ta1372) from thermoplasma acidophilum at 1.80 a resolution
PDB Compounds: (A:) hypothetical proteinSCOPe Domain Sequences for d2fura1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fura1 b.45.1.1 (A:16-208) Hypothetical protein Ta1372 {Thermoplasma acidophilum [TaxId: 2303]}
rasysdedlvamldrnftctvsfidggipyaipmmlasegktiylhgsmksriygilktg
qliaislleingivlakeiknnsinyvsalifgrpyeiddtekkievfrllteklvkgrw
dnsikpsyedlngvfvfavkpetfsmkartgpphdtstddiwsgvlpiqhtiseagenap
eyvkslygkrifi
SCOPe Domain Coordinates for d2fura1:
Click to download the PDB-style file with coordinates for d2fura1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fura1:
- d2fura1 first appeared in SCOP 1.73
- d2fura1 appears in SCOPe 2.07
View in 3D
