Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies) alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet |
Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) |
Family d.82.2.2: Nqo15-like [143572] (1 protein) overall structural similarity to the frataxin-like family automatically mapped to Pfam PF11497 |
Protein NADH-quinone oxidoreductase subunit 15, Nqo15 [143573] (1 species) |
Species Thermus thermophilus [TaxId:274] [143574] (4 PDB entries) Uniprot Q5SKZ7 3-129 |
Domain d2fug71: 2fug 7:3-129 [134132] Other proteins in same PDB: d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1 complexed with fes, fmn, sf4 |
PDB Entry: 2fug (more details), 3.3 Å
SCOPe Domain Sequences for d2fug71:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fug71 d.82.2.2 (7:3-129) NADH-quinone oxidoreductase subunit 15, Nqo15 {Thermus thermophilus [TaxId: 274]} asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra realafa
Timeline for d2fug71:
View in 3D Domains from other chains: (mouse over for more information) d2fug11, d2fug12, d2fug13, d2fug21, d2fug31, d2fug32, d2fug33, d2fug34, d2fug41, d2fug51, d2fug61, d2fug91, d2fuga1, d2fuga2, d2fuga3, d2fugb1, d2fugc1, d2fugc2, d2fugc3, d2fugc4, d2fugd1, d2fuge1, d2fugf1, d2fugg1, d2fugh1, d2fugj1, d2fugj2, d2fugj3, d2fugk1, d2fugl1, d2fugl2, d2fugl3, d2fugl4, d2fugm1, d2fugn1, d2fugo1, d2fugp1, d2fugq1, d2fugs1, d2fugs2, d2fugs3, d2fugt1, d2fugu1, d2fugu2, d2fugu3, d2fugu4, d2fugv1, d2fugw1, d2fugx1, d2fugy1, d2fugz1 |