Lineage for d2fuca1 (2fuc A:12-256)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919946Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 2919971Protein Phosphomannomutase 1 [142161] (1 species)
  7. 2919972Species Human (Homo sapiens) [TaxId:9606] [142162] (2 PDB entries)
    Uniprot Q92871 12-256
  8. 2919974Domain d2fuca1: 2fuc A:12-256 [134116]
    complexed with mg

Details for d2fuca1

PDB Entry: 2fuc (more details), 2.1 Å

PDB Description: human alpha-phosphomannomutase 1 with mg2+ cofactor bound
PDB Compounds: (A:) Phosphomannomutase 1

SCOPe Domain Sequences for d2fuca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fuca1 c.108.1.10 (A:12-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]}
ervlclfdvdgtltparqkidpevaaflqklrsrvqigvvggsdyckiaeqlgdgdevie
kfdyvfaengtvqykhgrllskqtiqnhlgeellqdlinfclsymallrlpkkrgtfief
rngmlnispigrsctleeriefseldkkekirekfvealktefagkglrfsrggmisfdv
fpegwdkrycldsldqdsfdtihffgnetspggndfeifadprtvghsvvspqdtvqrcr
eiffp

SCOPe Domain Coordinates for d2fuca1:

Click to download the PDB-style file with coordinates for d2fuca1.
(The format of our PDB-style files is described here.)

Timeline for d2fuca1: