Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins) contains an alpha+beta subdomain inserted into a new site after strand 3 |
Protein Phosphomannomutase 1 [142161] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142162] (2 PDB entries) Uniprot Q92871 12-256 |
Domain d2fuca1: 2fuc A:12-256 [134116] complexed with mg |
PDB Entry: 2fuc (more details), 2.1 Å
SCOPe Domain Sequences for d2fuca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fuca1 c.108.1.10 (A:12-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} ervlclfdvdgtltparqkidpevaaflqklrsrvqigvvggsdyckiaeqlgdgdevie kfdyvfaengtvqykhgrllskqtiqnhlgeellqdlinfclsymallrlpkkrgtfief rngmlnispigrsctleeriefseldkkekirekfvealktefagkglrfsrggmisfdv fpegwdkrycldsldqdsfdtihffgnetspggndfeifadprtvghsvvspqdtvqrcr eiffp
Timeline for d2fuca1: