Lineage for d2fu9a_ (2fu9 A:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) 
Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins) Protein Zn metallo-beta-lactamase [56283] (12 species) 
Species Xanthomonas maltophilia [TaxId:40324] [56286] (12 PDB entries) 
Domain d2fu9a_: 2fu9 A: [134112]
automated match to d1smla_
complexed with gol, mp2, so4, zn
Details for d2fu9a_
PDB Entry: 2fu9 (more details), 1.8 Å
PDB Description: Zinc-beta-lactamase L1 from stenotrophomonas maltophilia (mp2 inhibitor complex)
PDB Compounds: (A:) Metallo-beta-lactamase L1SCOPe Domain Sequences for d2fu9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fu9a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag
SCOPe Domain Coordinates for d2fu9a_:
Click to download the PDB-style file with coordinates for d2fu9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fu9a_:
- d2fu9a_ first appeared in SCOP 1.73, called d2fu9a1
- d2fu9a_ appears in SCOPe 2.04
- d2fu9a_ appears in SCOPe 2.06
- d2fu9a_ appears in the current release, SCOPe 2.08
View in 3D
