Lineage for d2fu3b3 (2fu3 B:499-653)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890089Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2890090Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2890184Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)
    automatically mapped to Pfam PF00994
  6. 2890185Protein Gephyrin, domain 5 [110647] (1 species)
  7. 2890186Species Norway rat (Rattus norvegicus) [TaxId:10116] [110648] (3 PDB entries)
    Uniprot Q03555 350-768 # structure on the N-terminal domain (1-201) is also known (1ihc; (64101))
  8. 2890189Domain d2fu3b3: 2fu3 B:499-653 [134101]
    Other proteins in same PDB: d2fu3a1, d2fu3a2, d2fu3b1, d2fu3b2
    automated match to d2fu3b3

Details for d2fu3b3

PDB Entry: 2fu3 (more details), 2.7 Å

PDB Description: crystal structure of gephyrin e-domain
PDB Compounds: (B:) gephyrin

SCOPe Domain Sequences for d2fu3b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fu3b3 c.57.1.2 (B:499-653) Gephyrin, domain 5 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllnal
negisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgvr
kiifalpgnpvsavvtcnlfvvpalrkmqgildpr

SCOPe Domain Coordinates for d2fu3b3:

Click to download the PDB-style file with coordinates for d2fu3b3.
(The format of our PDB-style files is described here.)

Timeline for d2fu3b3: