Class b: All beta proteins [48724] (176 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) automatically mapped to Pfam PF03454 |
Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins) |
Protein Gephyrin, C-terminal domain [110330] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [110331] (3 PDB entries) Uniprot Q03555 350-768 # structure on the N-terminal domain (1-201) is also known (1ihc; (64101)) |
Domain d2fu3a1: 2fu3 A:654-736 [134096] Other proteins in same PDB: d2fu3a2, d2fu3a3, d2fu3b2, d2fu3b3 automated match to d2fu3a1 |
PDB Entry: 2fu3 (more details), 2.7 Å
SCOPe Domain Sequences for d2fu3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fu3a1 b.85.6.1 (A:654-736) Gephyrin, C-terminal domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} ptiikarlscdvkldprpeyhrciltwhhqeplpwaqstgnqmssrlmsmrsangllmlp pkteqyvelhkgevvdvmvigrl
Timeline for d2fu3a1: