Class b: All beta proteins [48724] (178 folds) |
Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily) complex fold made of bifurcated and coiled b-sheets |
Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) automatically mapped to Pfam PF03453 |
Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins) |
Protein Gephyrin, domains 3 and 4 [110333] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [110334] (3 PDB entries) Uniprot Q03555 350-768 # structure on the N-terminal domain (1-201) is also known (1ihc; (64101)) |
Domain d2ftsa2: 2fts A:318-498 [134080] Other proteins in same PDB: d2ftsa1, d2ftsa3 automated match to d2ftsa2 |
PDB Entry: 2fts (more details), 2.41 Å
SCOPe Domain Sequences for d2ftsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ftsa2 b.103.1.1 (A:318-498) Gephyrin, domains 3 and 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]} mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk f
Timeline for d2ftsa2: