Lineage for d2fswa1 (2fsw A:3-104)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) 
contains a small beta-sheet (wing)
Family a.4.5.69: HxlR-like [140304] (6 proteins)
Pfam PF01638; DUF24; the N- and C-terminal helical extensions to the common fold form the dimer interface similar to that of the ArsR-like family (46801)
Protein Hypothetical protein PG0823 [140305] (1 species) Species Porphyromonas gingivalis [TaxId:837] [140306] (1 PDB entry)
Uniprot Q7M7B7 3-104
Domain d2fswa1: 2fsw A:3-104 [134042]
Details for d2fswa1
PDB Entry: 2fsw (more details), 2.16 Å
PDB Description: Crystal Structure of the Putative Transcriptional Regualator, MarR family from Porphyromonas gingivalis W83
PDB Compounds: (A:) PG_0823 proteinSCOPe Domain Sequences for d2fswa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fswa1 a.4.5.69 (A:3-104) Hypothetical protein PG0823 {Porphyromonas gingivalis [TaxId: 837]}
rkisdeecpvrksmqifagkwtlliifqinrriirygelkraipgisekmlidelkflcg
kglikkkqypevpprveysltplgekvlpiideiakfgmenl
SCOPe Domain Coordinates for d2fswa1:
Click to download the PDB-style file with coordinates for d2fswa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fswa1:
- d2fswa1 first appeared in SCOP 1.73
- d2fswa1 appears in SCOPe 2.07
View in 3D
