Lineage for d2fsja1 (2fsj A:165-325)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this fold
Family c.55.1.12: Ta0583-like [142481] (1 protein) Protein Hypothetical protein Ta0583 [142482] (1 species) Species Thermoplasma acidophilum [TaxId:2303] [142483] (3 PDB entries)
Uniprot Q9HKL4 1-164! Uniprot Q9HKL4 165-325
Domain d2fsja1: 2fsj A:165-325 [134025]
complexed with gol
Details for d2fsja1
PDB Entry: 2fsj (more details), 1.9 Å
PDB Description: Crystal structure of Ta0583, an archaeal actin homolog, native data
PDB Compounds: (A:) hypothetical protein Ta0583SCOPe Domain Sequences for d2fsja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Thermoplasma acidophilum [TaxId: 2303]}
ieqqpgygvvidvgsrttdvltinlmdmepvvelsfslqigvgdaisalsrkiaketgfv
vpfdlaqealshpvmfrqkqvggpevsgpiledlanriienirlnlrgevdrvtslipvg
ggsnligdrfeeiapgtlvkikpedlqfanalgyrdaaers
SCOPe Domain Coordinates for d2fsja1:
Click to download the PDB-style file with coordinates for d2fsja1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fsja1:
- d2fsja1 first appeared in SCOP 1.73
- d2fsja1 appears in SCOPe 2.07
View in 3D
