Class a: All alpha proteins [46456] (290 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) |
Family a.8.1.0: automated matches [254234] (1 protein) not a true family |
Protein automated matches [254530] (3 species) not a true protein |
Species Finegoldia magna [TaxId:334413] [255176] (1 PDB entry) |
Domain d2fs1a_: 2fs1 A: [241882] automated match to d2j5ya_ |
PDB Entry: 2fs1 (more details)
SCOPe Domain Sequences for d2fs1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fs1a_ a.8.1.0 (A:) automated matches {Finegoldia magna [TaxId: 334413]} meavdanslaqakeaaikelkqygigdyyiklinnaktvegveslkneilkalpte
Timeline for d2fs1a_: