Lineage for d2fs1a_ (2fs1 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2696963Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2697129Family a.8.1.0: automated matches [254234] (1 protein)
    not a true family
  6. 2697130Protein automated matches [254530] (3 species)
    not a true protein
  7. 2697131Species Finegoldia magna [TaxId:334413] [255176] (1 PDB entry)
  8. 2697132Domain d2fs1a_: 2fs1 A: [241882]
    automated match to d2j5ya_

Details for d2fs1a_

PDB Entry: 2fs1 (more details)

PDB Description: solution structure of psd-1
PDB Compounds: (A:) psd-1

SCOPe Domain Sequences for d2fs1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fs1a_ a.8.1.0 (A:) automated matches {Finegoldia magna [TaxId: 334413]}
meavdanslaqakeaaikelkqygigdyyiklinnaktvegveslkneilkalpte

SCOPe Domain Coordinates for d2fs1a_:

Click to download the PDB-style file with coordinates for d2fs1a_.
(The format of our PDB-style files is described here.)

Timeline for d2fs1a_: