Lineage for d2fr1a1 (2fr1 A:1657-1915)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
also known as short-chain dehydrogenases and SDR family
parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
has additional subdomain(s) that are not in the common domain
Protein Erythromycin synthase, eryAI, 1st ketoreductase module, C-terminal domain [418935] (1 species)
protein contains tandem repeat of two SDR-like modules resembling a dimer commonly found in the family; only the second module retains the coenzyme-binding siteSpecies Saccharopolyspora erythraea [TaxId:1836] [419373] (4 PDB entries)
Uniprot Q5UNP6
Domain d2fr1a1: 2fr1 A:1657-1915 [133961]
Other proteins in same PDB: d2fr1a2
automated match to d2fr0a1
complexed with ndp
has additional insertions and/or extensions that are not grouped together
Details for d2fr1a1
PDB Entry: 2fr1 (more details), 1.79 Å
PDB Description: The first ketoreductase of the erythromycin synthase (crystal form 2)
PDB Compounds: (A:) Erythromycin synthase, EryAISCOPe Domain Sequences for d2fr1a1:
Sequence, based on SEQRES records: (download)
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module, C-terminal domain {Saccharopolyspora erythraea [TaxId: 1836]}
atddewkptgtvlvtggtggvggqiarwlarrgaphlllvsrsgpdadgagelvaeleal
garttvaacdvtdresvrellggigddvplsavfhaaatlddgtvdtltgerierasrak
vlgarnlheltreldltafvlfssfasafgapglggyapgnayldglaqqrrsdglpata
vawgtwagsgmaegpvadrfrrhgviemppetacralqnaldraevcpividvrwdrfll
aytaqrptrlfdeiddarr
Sequence, based on observed residues (ATOM records): (download)
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module, C-terminal domain {Saccharopolyspora erythraea [TaxId: 1836]}
atddewkptgtvlvtggtggvggqiarwlarrgaphlllvsrsgpdadgagelvaeleal
garttvaacdvtdresvrellggigddvplsavfhaaatlddgtvdtltgerierasrak
vlgarnlheltreldltafvlfssfasafgapglggyapgnayldglaqqrrsdglpata
vawgtwafrrhgviemppetacralqnaldraevcpividvrwdrfllaytaqrptrlfd
eiddarr
SCOPe Domain Coordinates for d2fr1a1:
Click to download the PDB-style file with coordinates for d2fr1a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fr1a1:
- d2fr1a1 first appeared in SCOP 1.73
- d2fr1a1 appears in SCOPe 2.07
View in 3D
