Lineage for d2fpra1 (2fpr A:3-163)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.108: HAD-like [56783] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.108.1: HAD-like [56784] (26 families) 
usually contains an insertion (sub)domain after strand 1
Family c.108.1.19: Histidinol phosphatase-like [142177] (3 proteins)
no insertion subdomainsProtein Histidine biosynthesis bifunctional protein HisB, phosphatase domain [142178] (1 species) Species Escherichia coli [TaxId:562] [142179] (5 PDB entries)
Uniprot Q9S5G5 3-163
Domain d2fpra1: 2fpr A:3-163 [133919]
complexed with br, mg, na, zn
Details for d2fpra1
PDB Entry: 2fpr (more details), 1.7 Å
PDB Description: crystal structure the n-terminal domain of e. coli hisb. apo mg model.
PDB Compounds: (A:) Histidine biosynthesis bifunctional protein hisBSCOPe Domain Sequences for d2fpra1:
Sequence, based on SEQRES records: (download)
>d2fpra1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}
sqkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgt
qsfpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylaeqamd
ransyvigdratdiqlaenmginglrydretlnwpmigeql
Sequence, based on observed residues (ATOM records): (download)
>d2fpra1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]}
sqkylfidrdgtlisepdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgtqs
fpqadfdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylmdransyv
igdratdiqlaenmginglrydretlnwpmigeql
SCOPe Domain Coordinates for d2fpra1:
Click to download the PDB-style file with coordinates for d2fpra1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fpra1:
- d2fpra1 first appeared in SCOP 1.73
- d2fpra1 appears in SCOPe 2.06
- d2fpra1 appears in the current release, SCOPe 2.08
View in 3D
