Lineage for d2fpoa1 (2fpo A:10-192)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501814Family c.66.1.46: YhhF-like [142611] (6 proteins)
    Pfam PF03602
  6. 2501815Protein Methylase YhhF [142620] (1 species)
  7. 2501816Species Escherichia coli [TaxId:562] [142621] (1 PDB entry)
    Uniprot P0ADX9 10-192
  8. 2501817Domain d2fpoa1: 2fpo A:10-192 [133909]
    complexed with cl, edo

Details for d2fpoa1

PDB Entry: 2fpo (more details), 2.05 Å

PDB Description: Putative methyltransferase yhhF from Escherichia coli.
PDB Compounds: (A:) methylase yhhF

SCOPe Domain Sequences for d2fpoa1:

Sequence, based on SEQRES records: (download)

>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]}
gqiriiggqwrgrklpvpdspglrpttdrvretlfnwlapvivdaqcldcfagsgalgle
alsryaagatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdpp
frrglleetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqr
eaq

Sequence, based on observed residues (ATOM records): (download)

>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]}
gqiriiggqwrgrklpvpdstdrvretlfnwlapvivdaqcldcfagsgalglealsrya
agatliemdravsqqliknlatlkagnarvvnsnamsflaqkgtphnivfvdppfrrgll
eetinlledngwladealiyvesevenglptvpanwslhrekvagqvayrlyqreaq

SCOPe Domain Coordinates for d2fpoa1:

Click to download the PDB-style file with coordinates for d2fpoa1.
(The format of our PDB-style files is described here.)

Timeline for d2fpoa1: