![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Rab1a [142241] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142242] (3 PDB entries) Uniprot P62820 7-175 |
![]() | Domain d2fola1: 2fol A:5-173 [133883] complexed with gdp, mg, unx |
PDB Entry: 2fol (more details), 2.63 Å
SCOPe Domain Sequences for d2fola1:
Sequence, based on SEQRES records: (download)
>d2fola1 c.37.1.8 (A:5-173) Rab1a {Human (Homo sapiens) [TaxId: 9606]} ydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwdt agqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvgnkcd lttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm
>d2fola1 c.37.1.8 (A:5-173) Rab1a {Human (Homo sapiens) [TaxId: 9606]} ydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiwdy rgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvgnkcdlttkkvvdyttake fadslgipfletsaknatnveqsfmtmaaeikkrm
Timeline for d2fola1: