Lineage for d2fo8a1 (2fo8 A:3-110)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1524954Superfamily b.1.26: ICP-like [141066] (2 families) (S)
    topological variant with similarity to the Cupredoxin-like fold (49502) in the N-terminal region
  5. 1524955Family b.1.26.1: ICP-like [141067] (2 proteins)
    PfamB PB014070
    automatically mapped to Pfam PF09394
  6. 1524956Protein Chagasin [141068] (1 species)
  7. 1524957Species Trypanosoma cruzi [TaxId:5693] [141069] (8 PDB entries)
    Uniprot Q966X9 3-110
  8. 1524967Domain d2fo8a1: 2fo8 A:3-110 [133873]

Details for d2fo8a1

PDB Entry: 2fo8 (more details)

PDB Description: solution structure of the trypanosoma cruzi cysteine protease inhibitor chagasin
PDB Compounds: (A:) Chagasin

SCOPe Domain Sequences for d2fo8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fo8a1 b.1.26.1 (A:3-110) Chagasin {Trypanosoma cruzi [TaxId: 5693]}
hkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppds
kllgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan

SCOPe Domain Coordinates for d2fo8a1:

Click to download the PDB-style file with coordinates for d2fo8a1.
(The format of our PDB-style files is described here.)

Timeline for d2fo8a1: