SCOPe 2.08: Domain d2fnea1: 2fne A:1955-2042

Lineage for d2fnea1 (2fne A:1955-2042)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.36: PDZ domain-like [50155] (1 superfamily)
contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
Superfamily b.36.1: PDZ domain-like [50156] (7 families)
peptide-binding domain
Family b.36.1.1: PDZ domain [50157] (47 proteins)
Pfam PF00595
Protein Multiple PDZ domain protein [141267] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [141268] (4 PDB entries)
Uniprot Q5VZ62 1138-1243! Uniprot Q5VZ62 1955-2042
Domain d2fnea1: 2fne A:1955-2042 [133813]
Other proteins in same PDB: d2fnea2, d2fneb3, d2fneb4, d2fnec3, d2fnec4
PDZ 13

Details for d2fnea1

PDB Entry: 2fne (more details), 1.83 Å

PDB Description: The crystal structure of the 13th PDZ domain of MPDZ

PDB Compounds: (A:) Multiple PDZ domain protein

SCOPe Domain Sequences for d2fnea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]}
pqcksitlergpdglgfsivggygsphgdlpiyvktvfakgaasedgrlkrgdqiiavng
qslegvtheeavailkrtkgtvtlmvls

SCOPe Domain Coordinates for d2fnea1:

Click to download the PDB-style file with coordinates for d2fnea1.
(The format of our PDB-style files is described here.)

Timeline for d2fnea1: