Lineage for d2fnca_ (2fnc A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1880994Species Thermotoga maritima [TaxId:243274] [187721] (5 PDB entries)
  8. 1880999Domain d2fnca_: 2fnc A: [164443]
    automated match to d1anfa_
    complexed with mlr

Details for d2fnca_

PDB Entry: 2fnc (more details), 1.7 Å

PDB Description: thermotoga maritima maltotriose binding protein bound with maltotriose.
PDB Compounds: (A:) maltose ABC transporter, periplasmic maltose-binding protein

SCOPe Domain Sequences for d2fnca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnca_ c.94.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
kltiwcsekqvdilqklgeefkakygipvevqyvdfgsikskfltaapqgqgadiivgah
dwvgelavngliepipnfsdlknfydtalkafsyggklygvpyameavaliynkdyvdsv
pktmdeliekakqideeyggevrgfiydvanfyfsapfilgyggyvfketpqgldvtdig
lanegavkgaklikrmidegvltpgdnygtmdsmfkeglaamiinglwaiksykdaginy
gvapipelepgvpakpfvgvqgfminakspnkviamefltnfiarketmykiyladprlp
arkdvlelvkdnpdvvaftqsasmgtpmpnvpemapvwsamgdalsiiingqasvedalk
eavekikaqiekgshhhhh

SCOPe Domain Coordinates for d2fnca_:

Click to download the PDB-style file with coordinates for d2fnca_.
(The format of our PDB-style files is described here.)

Timeline for d2fnca_: