Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins) follows the extended AAA-ATPase domain |
Protein Hypothetical protein SSO1545, C-terminal domain [140261] (1 species) |
Species Sulfolobus solfataricus [TaxId:2287] [140262] (1 PDB entry) Uniprot Q97Y08 284-356 |
Domain d2fnaa1: 2fna A:284-356 [133809] Other proteins in same PDB: d2fnaa2, d2fnaa3, d2fnab2, d2fnab3 complexed with adp, edo, mg |
PDB Entry: 2fna (more details), 2 Å
SCOPe Domain Sequences for d2fnaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fnaa1 a.4.5.11 (A:284-356) Hypothetical protein SSO1545, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} reiarkrylnimrtlskcgkwsdvkraleleegieisdseiynyltqltkhswiikegek ycpseplislafs
Timeline for d2fnaa1: