Lineage for d2fnaa1 (2fna A:284-356)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1721707Family a.4.5.11: Helicase DNA-binding domain [46819] (4 proteins)
    follows the extended AAA-ATPase domain
  6. 1721732Protein Hypothetical protein SSO1545, C-terminal domain [140261] (1 species)
  7. 1721733Species Sulfolobus solfataricus [TaxId:2287] [140262] (1 PDB entry)
    Uniprot Q97Y08 284-356
  8. 1721734Domain d2fnaa1: 2fna A:284-356 [133809]
    Other proteins in same PDB: d2fnaa2, d2fnab2
    complexed with adp, edo, mg

Details for d2fnaa1

PDB Entry: 2fna (more details), 2 Å

PDB Description: Crystal structure of an archaeal aaa+ atpase (sso1545) from sulfolobus solfataricus p2 at 2.00 A resolution
PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d2fnaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fnaa1 a.4.5.11 (A:284-356) Hypothetical protein SSO1545, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
reiarkrylnimrtlskcgkwsdvkraleleegieisdseiynyltqltkhswiikegek
ycpseplislafs

SCOPe Domain Coordinates for d2fnaa1:

Click to download the PDB-style file with coordinates for d2fnaa1.
(The format of our PDB-style files is described here.)

Timeline for d2fnaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fnaa2