Lineage for d2fn8a_ (2fn8 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913580Species Thermotoga maritima [TaxId:243274] [187722] (4 PDB entries)
  8. 2913583Domain d2fn8a_: 2fn8 A: [204247]
    automated match to d2fn9a_
    complexed with rip

Details for d2fn8a_

PDB Entry: 2fn8 (more details), 2.15 Å

PDB Description: thermotoga maritima ribose binding protein ribose bound form
PDB Compounds: (A:) ribose ABC transporter, periplasmic ribose-binding protein

SCOPe Domain Sequences for d2fn8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fn8a_ c.93.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 243274]}
kgkmaivistlnnpwfvvlaetakqraeqlgyeatifdsqndtakesahfdaiiaagyda
iifnptdadgsianvkrakeagipvfcvdrginarglavaqiysdnyyggvlmgeyfvkf
lkekypdakeipyaellgilsaqptwdrsngfhsvvdqypefkmvaqqsaefdrdtaykv
teqilqahpeikaiwcgndamalgamkaceaagrtdiyifgfdgaedvinaikegkqiva
timqfpklmarlavewadqylrgersfpeivpvtvelvtrenidkytaygrk

SCOPe Domain Coordinates for d2fn8a_:

Click to download the PDB-style file with coordinates for d2fn8a_.
(The format of our PDB-style files is described here.)

Timeline for d2fn8a_: