Lineage for d2fk0a1 (2fk0 A:11-324)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385197Protein Hemagglutinin [49824] (19 species)
    includes rudiment esterase domain
  7. 2385289Species Influenza A virus, different strains [TaxId:11320] [49825] (127 PDB entries)
  8. 2385640Domain d2fk0a1: 2fk0 A:11-324 [133628]
    Other proteins in same PDB: d2fk0a2, d2fk0b1, d2fk0b2, d2fk0c2, d2fk0c3, d2fk0d2, d2fk0d3, d2fk0e2, d2fk0e3, d2fk0f2, d2fk0f3, d2fk0g2, d2fk0g3, d2fk0h2, d2fk0h3, d2fk0i2, d2fk0i3, d2fk0j2, d2fk0j3, d2fk0k2, d2fk0k3, d2fk0l2, d2fk0l3, d2fk0m2, d2fk0m3, d2fk0n2, d2fk0n3, d2fk0o2, d2fk0o3, d2fk0p2, d2fk0p3, d2fk0q2, d2fk0q3, d2fk0r2, d2fk0r3

Details for d2fk0a1

PDB Entry: 2fk0 (more details), 2.95 Å

PDB Description: crystal structure of a h5n1 influenza virus hemagglutinin.
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d2fk0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fk0a1 b.19.1.2 (A:11-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d2fk0a1:

Click to download the PDB-style file with coordinates for d2fk0a1.
(The format of our PDB-style files is described here.)

Timeline for d2fk0a1:

2385640
d2fk0a1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2fk0a2