Lineage for d2fjta_ (2fjt A:)
- Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds) 
Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through itSuperfamily d.63.1: CYTH-like phosphatases [55154] (3 families) 
Family d.63.1.0: automated matches [191434] (1 protein)
not a true familyProtein automated matches [190625] (3 species)
not a true proteinSpecies Yersinia pestis [TaxId:187410] [187713] (2 PDB entries) 
Domain d2fjta_: 2fjt A: [164408]
automated match to d2acaa1
complexed with so4
Details for d2fjta_
PDB Entry: 2fjt (more details), 1.9 Å
PDB Description: adenylyl cyclase class iv from yersinia pestis
PDB Compounds: (A:) Adenylyl cyclase class IVSCOPe Domain Sequences for d2fjta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjta_ d.63.1.0 (A:) automated matches {Yersinia pestis [TaxId: 187410]}
sehfvgkyevelkfrvmdlttlheqlvaqkataftlnnhekdiyldangqdladqqismv
lremnpsgirlwivkgpgaerceasniedvskvqsmlatlgyhpaftiekqrsiyfvgkf
hitvdhltglgdfaeiaimtddateldklkaecrdfantfglqvdqqeprsyrqllgf
SCOPe Domain Coordinates for d2fjta_:
Click to download the PDB-style file with coordinates for d2fjta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fjta_:
- d2fjta_ first appeared in SCOPe 2.01
- d2fjta_ appears in SCOPe 2.05
- d2fjta_ appears in SCOPe 2.07
- d2fjta_ appears in the current release, SCOPe 2.08
View in 3D
