Lineage for d2fima_ (2fim A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.23: Tubby C-terminal domain-like [54517] (1 superfamily)
beta-sheet folds into a barrel (n=12, S=12) around the central helixSuperfamily d.23.1: Tubby C-terminal domain-like [54518] (2 families) 
Family d.23.1.1: Transcriptional factor tubby, C-terminal domain [54519] (2 proteins)
automatically mapped to Pfam PF01167
Protein automated matches [190641] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187711] (3 PDB entries) 
Domain d2fima_: 2fim A: [164401]
automated match to d1c8za_
complexed with 3dp, so4
Details for d2fima_
PDB Entry: 2fim (more details), 1.9 Å
PDB Description: Structure of the C-terminal domain of Human Tubby-like protein 1
PDB Compounds: (A:) Tubby related protein 1SCOPe Domain Sequences for d2fima_:
Sequence, based on SEQRES records: (download)
>d2fima_ d.23.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prefvlrpapqgrtvrcrltrdkkgmdrgmypsyflhldtekkvfllagrkrkrsktany
lisidptnlsrggenfigklrsnllgnrftvfdngqnpqrgystnvaslrqelaaviyet
nvlgfrgprrmtviipgmsaenervpirprnasdgllvrwqnktleslielhnkppvwnd
dsgsytlnfqgrvtqasvknfqivhaddpdyivlqfgrvaedaftldyryplcalqafai
alssfd
Sequence, based on observed residues (ATOM records): (download)
>d2fima_ d.23.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prefvlrpapqgrtvrcrltrdkypsyflhldtekkvfllagrkrkrsktanylisidpt
nnfigklrsnllgnrftvfdngqnpqrgystnvaslrqelaaviyerrmtviipgmsaen
ervpirprnasdgllvrwqnktleslielhnkppvwnddsgsytlnfqgrvtqasvknfq
ivhaddpdyivlqfgrvaedaftldyryplcalqafaialssfd
SCOPe Domain Coordinates for d2fima_:
Click to download the PDB-style file with coordinates for d2fima_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fima_:
- d2fima_ first appeared in SCOPe 2.01
- d2fima_ appears in SCOPe 2.07
View in 3D
