Lineage for d2fidb1 (2fid B:14-73)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640823Family g.39.1.15: A20-like zinc finger [144187] (1 protein)
    Pfam PF01754
  6. 2640824Protein RabGEF1 (Rabex-5), ubiquitin-binding domain [144188] (2 species)
    binds to ubiquitin with the extended C-terminal helix
  7. 2640825Species Cow (Bos taurus) [TaxId:9913] [144189] (2 PDB entries)
    Uniprot O18973 14-73
  8. 2640829Domain d2fidb1: 2fid B:14-73 [133517]
    Other proteins in same PDB: d2fida_
    complexed with zn

Details for d2fidb1

PDB Entry: 2fid (more details), 2.8 Å

PDB Description: Crystal Structure of a Bovine Rabex-5 fragment complexed with ubiquitin
PDB Compounds: (B:) Rab5 GDP/GTP exchange factor

SCOPe Domain Sequences for d2fidb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fidb1 g.39.1.15 (B:14-73) RabGEF1 (Rabex-5), ubiquitin-binding domain {Cow (Bos taurus) [TaxId: 9913]}
qsellckkgcgyygnpawqgfcskcwreeyhkarqkqiqedwelaerlqreeeeafassq

SCOPe Domain Coordinates for d2fidb1:

Click to download the PDB-style file with coordinates for d2fidb1.
(The format of our PDB-style files is described here.)

Timeline for d2fidb1: