Class g: Small proteins [56992] (98 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.15: A20-like zinc finger [144187] (1 protein) Pfam PF01754 |
Protein RabGEF1 (Rabex-5), ubiquitin-binding domain [144188] (2 species) binds to ubiquitin with the extended C-terminal helix |
Species Cow (Bos taurus) [TaxId:9913] [144189] (2 PDB entries) Uniprot O18973 14-73 |
Domain d2fidb1: 2fid B:14-73 [133517] Other proteins in same PDB: d2fida_ complexed with zn |
PDB Entry: 2fid (more details), 2.8 Å
SCOPe Domain Sequences for d2fidb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fidb1 g.39.1.15 (B:14-73) RabGEF1 (Rabex-5), ubiquitin-binding domain {Cow (Bos taurus) [TaxId: 9913]} qsellckkgcgyygnpawqgfcskcwreeyhkarqkqiqedwelaerlqreeeeafassq
Timeline for d2fidb1: