Lineage for d2fhxa_ (2fhx A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheetsSuperfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) 
Family d.157.1.0: automated matches [191360] (1 protein)
not a true familyProtein automated matches [190418] (31 species)
not a true protein
Species Pseudomonas aeruginosa [TaxId:287] [187706] (20 PDB entries) 
Domain d2fhxa_: 2fhx A: [164393]
automated match to d1ddka_
complexed with azi, cl, edo, zn
Details for d2fhxa_
PDB Entry: 2fhx (more details), 1.9 Å
PDB Description: pseudomonas aeruginosa spm-1 metallo-beta-lactamase
PDB Compounds: (A:) spm-1SCOPe Domain Sequences for d2fhxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhxa_ d.157.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dhvdlpynltatkidsdvfvvtdrdfyssnvlvakmldgtvvivsspfenlgtqtlmdwv
aktmkpkkvvainthfhldgtggneiykkmgaetwssdltkqlrleenkkdrikaaefyk
nedlkrrilsshpvpadnvfdlkqgkvfsfsnelvevsfpgpahspdnvvvyfpkkkllf
ggcmikpkelgylgdanvkawpdsarrlkkfdakivipghgewggpemvnktikvaekav
gemrl
SCOPe Domain Coordinates for d2fhxa_:
Click to download the PDB-style file with coordinates for d2fhxa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fhxa_:
- d2fhxa_ first appeared in SCOPe 2.01
- d2fhxa_ appears in SCOPe 2.07
View in 3D
