![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) ![]() |
![]() | Family b.3.1.3: PUD-like [158932] (1 protein) Pfam PF03714; bacterial pullanase-associated domain |
![]() | Protein Pullulanase PulA [158933] (4 species) |
![]() | Species Klebsiella pneumoniae [TaxId:573] [158934] (3 PDB entries) Uniprot P07206 39-169 |
![]() | Domain d2fhfa3: 2fhf A:32-162 [147037] Other proteins in same PDB: d2fhfa1, d2fhfa2, d2fhfa4, d2fhfa5 complexed with ca, glc |
PDB Entry: 2fhf (more details), 1.65 Å
SCOPe Domain Sequences for d2fhfa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhfa3 b.3.1.3 (A:32-162) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} dvvvrlpdvavpgeavqasarqavihlvdiagitsstpadyatknlylwnnetcdalsap vadwndvsttptgsdkygpywvipltkesgcinvivrdgtnklidsdlrvsfsdftdrtv sviagnsavyd
Timeline for d2fhfa3:
![]() Domains from same chain: (mouse over for more information) d2fhfa1, d2fhfa2, d2fhfa4, d2fhfa5 |