Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
Protein Class alpha GST [81360] (8 species) |
Species Fasciola hepatica [TaxId:6192] [52879] (2 PDB entries) |
Domain d2fhea2: 2fhe A:1-80 [33018] Other proteins in same PDB: d2fhea1, d2fheb1 complexed with gsh |
PDB Entry: 2fhe (more details), 2.3 Å
SCOPe Domain Sequences for d2fhea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} paklgywkirglqqpvrllleylgekyeeqiyerddgekwfskkfelgldlpnlpyyidd kckltqslailryiadkhgm
Timeline for d2fhea2: