![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins) Pfam PF04909; Amidohydrolase; stand-alone domain |
![]() | Protein Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699 [141820] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [141821] (1 PDB entry) Uniprot Q88M75 10-280 |
![]() | Domain d2ffia1: 2ffi A:10-280 [133385] Other proteins in same PDB: d2ffia2, d2ffib3 complexed with po4 |
PDB Entry: 2ffi (more details), 2.61 Å
SCOPe Domain Sequences for d2ffia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ffia1 c.1.9.15 (A:10-280) Putative 2-pyrone-4,6-dicarboxylic acid hydrolase PP1699 {Pseudomonas putida [TaxId: 303]} lhltaidshahvfsrglnlasqrryapnydaplgdylgqlrahgfshgvlvqpsflgtdn ryllsalqtvpgqlrgvvmlerdveqatlaemarlgvrgvrlnlmgqdmpdltgaqwrpl lerigeqgwhvelhrqvadipvlvralqpygldividhfgrpdarrglgqpgfaelltls grgkvwvkvsgiyrlqgspeenlafarqalcaleahygaerlmwgsdwphtqhesevsfg saveqfealgcsaqlrqallldtaralfgfe
Timeline for d2ffia1: