Lineage for d2ffha1 (2ffh A:1-88)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313661Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) (S)
  5. 2313662Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 2313677Protein Signal sequence recognition protein Ffh [47366] (3 species)
  7. 2313689Species Thermus aquaticus [TaxId:271] [47367] (16 PDB entries)
  8. 2313714Domain d2ffha1: 2ffh A:1-88 [16965]
    Other proteins in same PDB: d2ffha2, d2ffha3, d2ffhb2, d2ffhb3, d2ffhc2, d2ffhc3
    complexed with cd, so4

Details for d2ffha1

PDB Entry: 2ffh (more details), 3.2 Å

PDB Description: the signal sequence binding protein ffh from thermus aquaticus
PDB Compounds: (A:) protein (ffh)

SCOPe Domain Sequences for d2ffha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ffha1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
gkqvlesltpaevilatvyealkealgg

SCOPe Domain Coordinates for d2ffha1:

Click to download the PDB-style file with coordinates for d2ffha1.
(The format of our PDB-style files is described here.)

Timeline for d2ffha1: