Lineage for d2ffga1 (2ffg A:2-79)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010701Fold d.317: YkuJ-like [143566] (1 superfamily)
    alpha-beta(4)-alpha; 2 layers a/b; antiparallel beta-sheet, order 1234
  4. 3010702Superfamily d.317.1: YkuJ-like [143567] (1 family) (S)
    automatically mapped to Pfam PF08796
  5. 3010703Family d.317.1.1: YkuJ-like [143568] (1 protein)
  6. 3010704Protein Hypothetical protein YkuJ [143569] (1 species)
  7. 3010705Species Bacillus subtilis [TaxId:1423] [143570] (1 PDB entry)
    Uniprot O34588 2-79
  8. 3010706Domain d2ffga1: 2ffg A:2-79 [133383]
    Other proteins in same PDB: d2ffga2, d2ffgb3

Details for d2ffga1

PDB Entry: 2ffg (more details), 2.31 Å

PDB Description: Novel x-ray structure of the YkuJ protein from Bacillus subtilis. Northeast Structural Genomics target SR360.
PDB Compounds: (A:) ykuJ

SCOPe Domain Sequences for d2ffga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ffga1 d.317.1.1 (A:2-79) Hypothetical protein YkuJ {Bacillus subtilis [TaxId: 1423]}
sqlmgiitrlqslqetaeaanepmqryfevngekicsvkyfeknqtfeltvfqkgekpnt
ypfdnidmvsieifellq

SCOPe Domain Coordinates for d2ffga1:

Click to download the PDB-style file with coordinates for d2ffga1.
(The format of our PDB-style files is described here.)

Timeline for d2ffga1:

3010706
d2ffga1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2ffga2