Lineage for d2fe3a_ (2fe3 A:)
- Root: SCOPe 2.07
Class a: All alpha proteins [46456] (289 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) 
contains a small beta-sheet (wing)
Family a.4.5.0: automated matches [191329] (1 protein)
not a true familyProtein automated matches [190154] (87 species)
not a true protein
Species Bacillus subtilis [TaxId:1423] [187193] (7 PDB entries) 
Domain d2fe3a_: 2fe3 A: [204206]
automated match to d2o03a_
complexed with zn
Details for d2fe3a_
PDB Entry: 2fe3 (more details), 1.75 Å
PDB Description: The crystal structure of bacillus subtilis PerR-Zn reveals a novel Zn(Cys)4 Structural redox switch
PDB Compounds: (A:) Peroxide operon regulatorSCOPe Domain Sequences for d2fe3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fe3a_ a.4.5.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
helkealetlketgvritpqrhaileylvnsmahptaddiykalegkfpnmsvatvynnl
rvfresglvkeltygdassrfdfvtsdhyhaicencgkivdfhypgldeveqlaahvtgf
kvshhrleiygvcqecskken
SCOPe Domain Coordinates for d2fe3a_:
Click to download the PDB-style file with coordinates for d2fe3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2fe3a_:
- d2fe3a_ first appeared in SCOPe 2.03
- d2fe3a_ appears in SCOPe 2.06
- d2fe3a_ appears in the current release, SCOPe 2.08
View in 3D
