Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.10: AlkB-like [141628] (3 proteins) automatically mapped to Pfam PF13532 |
Protein Alkylated DNA repair protein AlkB [141629] (1 species) |
Species Escherichia coli [TaxId:562] [141630] (11 PDB entries) Uniprot P05050 15-214 |
Domain d2fd8a1: 2fd8 A:15-214 [133296] protein/DNA complex; complexed with akg, fe2 |
PDB Entry: 2fd8 (more details), 2.3 Å
SCOPe Domain Sequences for d2fd8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fd8a1 b.82.2.10 (A:15-214) Alkylated DNA repair protein AlkB {Escherichia coli [TaxId: 562]} laagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthrq gylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqdk depdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplka gfhpltidcrynltfrqagk
Timeline for d2fd8a1: