Lineage for d2fd8a1 (2fd8 A:15-214)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962884Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 963404Superfamily b.82.2: Clavaminate synthase-like [51197] (14 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 963621Family b.82.2.10: AlkB-like [141628] (3 proteins)
  6. 963625Protein Alkylated DNA repair protein AlkB [141629] (1 species)
  7. 963626Species Escherichia coli [TaxId:562] [141630] (10 PDB entries)
    Uniprot P05050 15-214
  8. 963636Domain d2fd8a1: 2fd8 A:15-214 [133296]
    protein/DNA complex; complexed with akg, fe2

Details for d2fd8a1

PDB Entry: 2fd8 (more details), 2.3 Å

PDB Description: crystal structure of alkb in complex with fe(ii), 2-oxoglutarate, and methylated trinucleotide t-mea-t
PDB Compounds: (A:) Alkylated DNA repair protein alkB

SCOPe Domain Sequences for d2fd8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fd8a1 b.82.2.10 (A:15-214) Alkylated DNA repair protein AlkB {Escherichia coli [TaxId: 562]}
laagavilrrfafnaaeqlirdindvasqspfrqmvtpggytmsvamtncghlgwtthrq
gylyspidpqtnkpwpampqsfhnlcqraataagypdfqpdaclinryapgaklslhqdk
depdlrapivsvslglpaifqfgglkrndplkrlllehgdvvvwggesrlfyhgiqplka
gfhpltidcrynltfrqagk

SCOPe Domain Coordinates for d2fd8a1:

Click to download the PDB-style file with coordinates for d2fd8a1.
(The format of our PDB-style files is described here.)

Timeline for d2fd8a1: