Lineage for d2fd6l1 (2fd6 L:1-106A)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2022563Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2023157Species Mouse (Mus musculus), cluster 3.4 [TaxId:10090] [88530] (4 PDB entries)
  8. 2023159Domain d2fd6l1: 2fd6 L:1-106A [145157]
    Other proteins in same PDB: d2fd6a1, d2fd6a2, d2fd6h1, d2fd6h2, d2fd6l2, d2fd6u1, d2fd6u2, d2fd6u3
    complexed with edo, etx, nag, ndg, pg4, pge, so4

Details for d2fd6l1

PDB Entry: 2fd6 (more details), 1.9 Å

PDB Description: structure of human urokinase plasminogen activator in complex with urokinase receptor and an anti-upar antibody at 1.9 a
PDB Compounds: (L:) L chain of Fab of ATN-615 anti-uPAR antibody

SCOPe Domain Sequences for d2fd6l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fd6l1 b.1.1.1 (L:1-106A) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.4 [TaxId: 10090]}
divltqspditaaslgqkvtitcsasssvsymhwyqqksgtspkpwifeisklasgvpar
fsgsgsgtsysltissmeaedaaiyycqqwnypftfgggtkleik

SCOPe Domain Coordinates for d2fd6l1:

Click to download the PDB-style file with coordinates for d2fd6l1.
(The format of our PDB-style files is described here.)

Timeline for d2fd6l1: