Lineage for d2fcta1 (2fct A:3-310)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. Family b.82.2.9: PhyH-like [141623] (3 proteins)
    Pfam PF05721
  6. Protein Syringomycin biosynthesis enzyme 2, SyrB2 [141624] (1 species)
  7. Species Pseudomonas syringae pv. syringae [TaxId:321] [141625] (3 PDB entries)
    Uniprot Q9RBY6 3-310
  8. Domain d2fcta1: 2fct A:3-310 [133282]
    complexed with akg, cl, dsu, fe2

Details for d2fcta1

PDB Entry: 2fct (more details), 1.6 Å

PDB Description: SyrB2 with Fe(II), chloride, and alpha-ketoglutarate
PDB Compounds: (A:) syringomycin biosynthesis enzyme 2

SCOPe Domain Sequences for d2fcta1:

Sequence, based on SEQRES records: (download)

>d2fcta1 b.82.2.9 (A:3-310) Syringomycin biosynthesis enzyme 2, SyrB2 {Pseudomonas syringae pv. syringae [TaxId: 321]}
kkfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdldaisggtn
ianydrhldddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhqadtfa
nasgkpqiiwpeneefggtitvwtaftdaniangclqfipgtqnsmnydetkrmtyepda
nnsvvkdgvrrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhasyphsg
esqemrmgfasryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrlvthtt
rgkkfeav

Sequence, based on observed residues (ATOM records): (download)

>d2fcta1 b.82.2.9 (A:3-310) Syringomycin biosynthesis enzyme 2, SyrB2 {Pseudomonas syringae pv. syringae [TaxId: 321]}
kkfaltaeqrasfekngfigpfdayspeemketwkrtrlrlldrsaaayqdldatniany
drhldddflashicrpeicdrvesilgpnvlcwrteffpkypgdegtdwhqadtfanasg
kpqiiwpeneefggtitvwtaftdaniangclqfipgtqnsmnydetkrmtyepdannsv
vkdgvrrgffgydyrqlqidenwkpdeasavpmqmkagqfiifwstlmhasyphsgesqe
mrmgfasryvpsfvhvypdsdhieeyggrislekygavqvigdetpeynrlvthttrgkk
feav

SCOPe Domain Coordinates for d2fcta1 are not available.

Timeline for d2fcta1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fctb_