Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins) The N- and C-terminal helical extensions to the common fold form the dimer interface |
Protein Transcriptional regulator PA3341 [140249] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [140250] (1 PDB entry) Uniprot Q9HYQ4 8-144 |
Domain d2fbha1: 2fbh A:8-144 [133245] complexed with hg, so4, zn |
PDB Entry: 2fbh (more details), 1.8 Å
SCOPe Domain Sequences for d2fbha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]} yfgtllaqtsrawraeldrrlshlglsqarwlvllhlarhrdsptqrelaqsvgvegptl arlldglesqglvrrlavaedrrakhivltpkadvliadieaiaasvrndvltgideseq alcqqvllrilanlenr
Timeline for d2fbha1: