Lineage for d2fbha1 (2fbh A:8-144)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693716Family a.4.5.28: MarR-like transcriptional regulators [63379] (20 proteins)
    The N- and C-terminal helical extensions to the common fold form the dimer interface
  6. 2693800Protein Transcriptional regulator PA3341 [140249] (1 species)
  7. 2693801Species Pseudomonas aeruginosa [TaxId:287] [140250] (1 PDB entry)
    Uniprot Q9HYQ4 8-144
  8. 2693802Domain d2fbha1: 2fbh A:8-144 [133245]
    complexed with hg, so4, zn

Details for d2fbha1

PDB Entry: 2fbh (more details), 1.8 Å

PDB Description: The crystal structure of transcriptional regulator PA3341
PDB Compounds: (A:) transcriptional regulator PA3341

SCOPe Domain Sequences for d2fbha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbha1 a.4.5.28 (A:8-144) Transcriptional regulator PA3341 {Pseudomonas aeruginosa [TaxId: 287]}
yfgtllaqtsrawraeldrrlshlglsqarwlvllhlarhrdsptqrelaqsvgvegptl
arlldglesqglvrrlavaedrrakhivltpkadvliadieaiaasvrndvltgideseq
alcqqvllrilanlenr

SCOPe Domain Coordinates for d2fbha1:

Click to download the PDB-style file with coordinates for d2fbha1.
(The format of our PDB-style files is described here.)

Timeline for d2fbha1: