SCOPe 2.08: Domain d2fbea1: 2fbe A:8-188

Lineage for d2fbea1 (2fbe A:8-188)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topology
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)
Family b.29.1.22: SPRY domain [141154] (6 proteins)
Pfam PF00622
Protein Similar to Ret finger protein-like 1 [141157] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [141158] (1 PDB entry)
Domain d2fbea1: 2fbe A:8-188 [133241]
Other proteins in same PDB: d2fbea2, d2fbeb3, d2fbec3, d2fbed3

Details for d2fbea1

PDB Entry: 2fbe (more details), 2.52 Å

PDB Description: Crystal Structure of the PRYSPRY-domain

PDB Compounds: (A:) PREDICTED: similar to ret finger protein-like 1

SCOPe Domain Sequences for d2fbea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fbea1 b.29.1.22 (A:8-188) Similar to Ret finger protein-like 1 {Human (Homo sapiens) [TaxId: 9606]}
fqvdmtfdvdtannyliisedlrsfrsgdlsqnrkeqaerfdtalcvlgtprftsgrhyw
evdvgtsqvwdvgvckesvnrqgkielssehgfltvgcregkvfaastvpmtplwvspql
hrvgifldvgmrsiafynvsdgchiytfieipvcepwrpffahkrgsqddqsilsicsvi
n

SCOPe Domain Coordinates for d2fbea1:

Click to download the PDB-style file with coordinates for d2fbea1.
(The format of our PDB-style files is described here.)

Timeline for d2fbea1: