Lineage for d2f9ma_ (2f9m A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475569Protein Rab11b [142237] (1 species)
  7. 2475570Species Human (Homo sapiens) [TaxId:9606] [142238] (2 PDB entries)
    Uniprot Q15907 7-181
  8. 2475572Domain d2f9ma_: 2f9m A: [133167]
    automated match to d2f9la1
    complexed with gnp, mg, ni

Details for d2f9ma_

PDB Entry: 2f9m (more details), 1.95 Å

PDB Description: 3d structure of active human rab11b gtpase
PDB Compounds: (A:) RAB11B, member RAS oncogene family

SCOPe Domain Sequences for d2f9ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f9ma_ c.37.1.8 (A:) Rab11b {Human (Homo sapiens) [TaxId: 9606]}
mydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
tagqeryrritsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
dlrhlravptdearafaeknnlsfietsaldstnveeafknilteiyrivsqkqiadraa
hd

SCOPe Domain Coordinates for d2f9ma_:

Click to download the PDB-style file with coordinates for d2f9ma_.
(The format of our PDB-style files is described here.)

Timeline for d2f9ma_: