Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab11b [142237] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142238] (2 PDB entries) Uniprot Q15907 7-181 |
Domain d2f9ma_: 2f9m A: [133167] automated match to d2f9la1 complexed with gnp, mg, ni |
PDB Entry: 2f9m (more details), 1.95 Å
SCOPe Domain Sequences for d2f9ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f9ma_ c.37.1.8 (A:) Rab11b {Human (Homo sapiens) [TaxId: 9606]} mydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd tagqeryrritsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks dlrhlravptdearafaeknnlsfietsaldstnveeafknilteiyrivsqkqiadraa hd
Timeline for d2f9ma_: