![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Pre-mRNA branch site protein p14 [143316] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143317] (2 PDB entries) Uniprot Q9Y3B4 12-125 |
![]() | Domain d2f9da1: 2f9d A:12-125 [133159] Other proteins in same PDB: d2f9dp_, d2f9dq_ complex with peptide from Splicing factor 3B subunit 1 (Uniprot O75533 373-415), chains P and Q |
PDB Entry: 2f9d (more details), 2.5 Å
SCOPe Domain Sequences for d2f9da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} rlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdak nacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk
Timeline for d2f9da1: