Lineage for d2f9da1 (2f9d A:12-125)
- Root: SCOPe 2.01
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) 
Family d.58.7.1: Canonical RBD [54929] (68 proteins) 
Protein Pre-mRNA branch site protein p14 [143316] (1 species) Species Human (Homo sapiens) [TaxId:9606] [143317] (2 PDB entries)
Uniprot Q9Y3B4 12-125
Domain d2f9da1: 2f9d A:12-125 [133159]
complex with peptide from Splicing factor 3B subunit 1 (Uniprot O75533 373-415), chains P and Q
Details for d2f9da1
PDB Entry: 2f9d (more details), 2.5 Å
PDB Description: 2.5 angstrom resolution structure of the spliceosomal protein p14 bound to region of sf3b155
PDB Compounds: (A:) Pre-mRNA branch site protein p14SCOPe Domain Sequences for d2f9da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]}
rlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifdak
nacdhlsgfnvcnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk
SCOPe Domain Coordinates for d2f9da1:
Click to download the PDB-style file with coordinates for d2f9da1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2f9da1:
- d2f9da1 first appeared in SCOP 1.73
- d2f9da1 appears in SCOP 1.75
- d2f9da1 appears in SCOPe 2.02
- d2f9da1 appears in the current release, SCOPe 2.08
View in 3D
