| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
| Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
| Protein Ribonuclease T [142497] (1 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [142498] (1 PDB entry) Uniprot Q9HY82 19-220 |
| Domain d2f96a1: 2f96 A:19-220 [133153] complexed with mg |
PDB Entry: 2f96 (more details), 2.09 Å
SCOPe Domain Sequences for d2f96a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f96a1 c.55.3.5 (A:19-220) Ribonuclease T {Pseudomonas aeruginosa [TaxId: 287]}
rhpmarrfrgylpvvvdvetggfnsatdalleiaattvgmdekgflfpehtyffriepfe
ganiepaaleftgikldhplrmavqeeaalteifrgirkalkangckrailvghnssfdl
gflnaavartgikrnpfhpfssfdtatlaglaygqtvlakacqaagmefdnreahsaryd
tektaelfcgivnrwkemggwm
Timeline for d2f96a1: