Lineage for d2f8aa1 (2f8a A:12-195)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the restSuperfamily c.47.1: Thioredoxin-like [52833] (24 families) 
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) 
Protein Glutathione peroxidase [52902] (2 species)
contains many insertions in the common foldSpecies Human (Homo sapiens) [TaxId:9606] [142365] (1 PDB entry)
Uniprot P07203 12-195
Domain d2f8aa1: 2f8a A:12-195 [133119]
Other proteins in same PDB: d2f8aa2
complexed with mla; mutant
Details for d2f8aa1
PDB Entry: 2f8a (more details), 1.5 Å
PDB Description: crystal structure of the selenocysteine to glycine mutant of human glutathione peroxidase 1
PDB Compounds: (A:) Glutathione peroxidase 1SCOPe Domain Sequences for d2f8aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]}
qsvyafsarplaggepvslgslrgkvllienvaslggttvrdytqmnelqrrlgprglvv
lgfpcnqfghqenakneeilnslkyvrpgggfepnfmlfekcevngagahplfaflreal
papsddatalmtdpklitwspvcrndvawnfekflvgpdgvplrrysrrfqtidiepdie
alls
SCOPe Domain Coordinates for d2f8aa1:
Click to download the PDB-style file with coordinates for d2f8aa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2f8aa1:
- d2f8aa1 first appeared in SCOP 1.73
- d2f8aa1 appears in SCOPe 2.07
View in 3D
