Lineage for d2f7fa1 (2f7f A:141-485)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) 
incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
Family c.1.17.1: NadC C-terminal domain-like [51691] (4 proteins) Protein Putative nicotinate phosphoribosyltransferase EF2626 [141859] (1 species)
includes extra C-terminal region that wraps around the N-terminal domain and contains an all-beta domain, this domain is distinct from but probably related to the Ta1145 extra domainSpecies Enterococcus faecalis [TaxId:1351] [141860] (2 PDB entries)
Uniprot Q830Y8 141-485
Domain d2f7fa1: 2f7f A:141-485 [133088]
Other proteins in same PDB: d2f7fa2
complexed with dpo, gol, nio, so4
has additional subdomain(s) that are not in the common domain
Details for d2f7fa1
PDB Entry: 2f7f (more details), 2 Å
PDB Description: crystal structure of enterococcus faecalis putative nicotinate phosphoribosyltransferase, new york structural genomics consortium
PDB Compounds: (A:) nicotinate phosphoribosyltransferase, putativeSCOPe Domain Sequences for d2f7fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f7fa1 c.1.17.1 (A:141-485) Putative nicotinate phosphoribosyltransferase EF2626 {Enterococcus faecalis [TaxId: 1351]}
iatkaariksvigddpllefgtrraqeldaaiwgtraayiggadatsnvragkifgipvs
gthahslvqsygndyeafmayakthrdcvflvdtydtlkagvpsairvaremgdkinflg
vridsgdmayiskrvreqldeagfteakiyasndldentilnlkmqkskidvwgvgtkli
taydqpalgavfklvsiegedgqmkdtiklssnaekvttpgkkqvwritrksdkksegdy
vtlwnedprqeeeiymfhpvhtfinkyvrdfearpvlqdifvegkrvyelptldeikqya
kenldslheeykrdlnpqkypvdlstdcwnhkmnllekvrkdvkh
SCOPe Domain Coordinates for d2f7fa1:
Click to download the PDB-style file with coordinates for d2f7fa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2f7fa1:
- d2f7fa1 first appeared in SCOP 1.73
- d2f7fa1 appears in SCOPe 2.07
View in 3D
