Class a: All alpha proteins [46456] (290 folds) |
Fold a.265: Fic-like [140930] (1 superfamily) multihelical; one central helix is surrounded by seven helices |
Superfamily a.265.1: Fic-like [140931] (1 family) |
Family a.265.1.1: Fic-like [140932] (3 proteins) Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix |
Protein Cell filamentation protein Fic [140933] (1 species) |
Species Helicobacter pylori [TaxId:210] [140934] (1 PDB entry) Uniprot O25774 1-177 |
Domain d2f6sa1: 2f6s A:1-177 [133058] Other proteins in same PDB: d2f6sa2, d2f6sa3, d2f6sb3, d2f6sb4 complexed with po4, zn |
PDB Entry: 2f6s (more details), 2.5 Å
SCOPe Domain Sequences for d2f6sa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f6sa1 a.265.1.1 (A:1-177) Cell filamentation protein Fic {Helicobacter pylori [TaxId: 210]} mhldrqslekakhliqsglidtievgtikglqeihrflfeglyefagkirdkniakgnfr fanclyldlilpriesmpqnnfnqivekyvemniahpflegngratriwldlllkkelkk ivlwdridkaaylsamerspvndleiktllkkhlssntndpltlikgitqsyyyegl
Timeline for d2f6sa1: