Lineage for d2f6sa1 (2f6s A:1-177)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738537Fold a.265: Fic-like [140930] (1 superfamily)
    multihelical; one central helix is surrounded by seven helices
  4. 2738538Superfamily a.265.1: Fic-like [140931] (1 family) (S)
  5. 2738539Family a.265.1.1: Fic-like [140932] (3 proteins)
    Pfam PF02661; the conserved motif HPFXXGNG is at the N-terminus of the central helix
  6. 2738540Protein Cell filamentation protein Fic [140933] (1 species)
  7. 2738541Species Helicobacter pylori [TaxId:210] [140934] (1 PDB entry)
    Uniprot O25774 1-177
  8. 2738542Domain d2f6sa1: 2f6s A:1-177 [133058]
    Other proteins in same PDB: d2f6sa2, d2f6sa3, d2f6sb3, d2f6sb4
    complexed with po4, zn

Details for d2f6sa1

PDB Entry: 2f6s (more details), 2.5 Å

PDB Description: structure of cell filamentation protein (fic) from helicobacter pylori
PDB Compounds: (A:) cell filamentation protein, putative

SCOPe Domain Sequences for d2f6sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f6sa1 a.265.1.1 (A:1-177) Cell filamentation protein Fic {Helicobacter pylori [TaxId: 210]}
mhldrqslekakhliqsglidtievgtikglqeihrflfeglyefagkirdkniakgnfr
fanclyldlilpriesmpqnnfnqivekyvemniahpflegngratriwldlllkkelkk
ivlwdridkaaylsamerspvndleiktllkkhlssntndpltlikgitqsyyyegl

SCOPe Domain Coordinates for d2f6sa1:

Click to download the PDB-style file with coordinates for d2f6sa1.
(The format of our PDB-style files is described here.)

Timeline for d2f6sa1: