Lineage for d2f6ka1 (2f6k A:2-307)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) 
the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
has transition metal ions bound inside the barrel
Family c.1.9.15: PP1699/LP2961-like [141819] (6 proteins)
Pfam PF04909; Amidohydrolase; stand-alone domain
Protein Putative amidohydrolase LP2961 [141828] (1 species) Species Lactobacillus plantarum [TaxId:1590] [141829] (1 PDB entry)
Uniprot Q88TJ2 2-307
Domain d2f6ka1: 2f6k A:2-307 [133047]
complexed with mn
Details for d2f6ka1
PDB Entry: 2f6k (more details), 2.5 Å
PDB Description: crystal structure of amidohydrorolase ii; northeast structural genomics target lpr24
PDB Compounds: (A:) metal-dependent hydrolaseSCOPe Domain Sequences for d2f6ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f6ka1 c.1.9.15 (A:2-307) Putative amidohydrolase LP2961 {Lactobacillus plantarum [TaxId: 1590]}
skidfhthylptsyvealkrhvpgdpdgwptpewtpqltlnfmrdndisysilslssphv
nfgdkaetirlveaanddgkslaqqypdqlgylaslpipyeldavktvqqaldqdgalgv
tvptnsrglyfgspvlervyqeldarqaivalhpnepailpknvdidlpvpllgffmdtt
mtfinmlkyhffekypnikviiphagaflgivddriaqyaqkvyqvdvydvmhhvyfdva
gavlprqlptlmslaqpehllygsdipytpldgsrqlghalattdlltneqkqaifydna
hrllte
SCOPe Domain Coordinates for d2f6ka1:
Click to download the PDB-style file with coordinates for d2f6ka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2f6ka1:
- d2f6ka1 first appeared in SCOP 1.73
- d2f6ka1 appears in SCOPe 2.03
- d2f6ka1 appears in SCOPe 2.05
- d2f6ka1 appears in the current release, SCOPe 2.08
View in 3D
